(data stored in ACNUC7421 zone)

EMBL: CR954246.PE32

CR954246.PE32        Location/Qualifiers
FT   CDS             33743..33997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0032"
FT                   /product="putative unknown membrane associated protein
FT                   YrdB"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85146"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI5"
FT                   /protein_id="CAI85146.1"
FT                   /translation="MNQAIQFIDRLEFREPAHQLVFFAQVNGMLVECVIAVSSLGLTDE
FT                   SHATSYFEKNRFDYEERAEQLIEDESYNSAGQIEVSLIS"
     MNQAIQFIDR LEFREPAHQL VFFAQVNGML VECVIAVSSL GLTDESHATS YFEKNRFDYE        60
     ERAEQLIEDE SYNSAGQIEV SLIS                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page