(data stored in ACNUC7421 zone)

EMBL: CR954246.PE321

CR954246.PE321       Location/Qualifiers
FT   CDS             348643..349563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0336"
FT                   /product="putative histone deacetylase family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85435"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF01"
FT                   /protein_id="CAI85435.1"
FT                   /translation="MRTAIISHPHCRKHKMIDDHPECPERLDAINDRLLASGLDIAIEQ
FT                   KQAPKAQREHYLLAHDESLVSFVESKIPTQGLVDLDGDTWLCPDSLKAIERAVGAGILA
FT                   VDEILEGNLDAAFCSVRPPGHHANRTTSSGFCVFNNLAIAVKYAQSKGVKRIAIVDFDV
FT                   HHGNGTQDIFIDDKNVLFCSLFQHPFYPNTVVENNTTLVNSPLPIASDGNDLKAVFEQQ
FT                   WLPKLNAFKPDMLFISAGFDAHLEDDMASLKFVEEDYRWLTEQLARFSEQHNCRGIVSY
FT                   LEGGYALSALGRSAIAHVKALVDYE"
     MRTAIISHPH CRKHKMIDDH PECPERLDAI NDRLLASGLD IAIEQKQAPK AQREHYLLAH        60
     DESLVSFVES KIPTQGLVDL DGDTWLCPDS LKAIERAVGA GILAVDEILE GNLDAAFCSV       120
     RPPGHHANRT TSSGFCVFNN LAIAVKYAQS KGVKRIAIVD FDVHHGNGTQ DIFIDDKNVL       180
     FCSLFQHPFY PNTVVENNTT LVNSPLPIAS DGNDLKAVFE QQWLPKLNAF KPDMLFISAG       240
     FDAHLEDDMA SLKFVEEDYR WLTEQLARFS EQHNCRGIVS YLEGGYALSA LGRSAIAHVK       300
     ALVDYE                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page