(data stored in ACNUC7421 zone)

EMBL: CR954246.PE322

CR954246.PE322       Location/Qualifiers
FT   CDS             complement(349546..349836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0337"
FT                   /product="putative orphan protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85436"
FT                   /db_xref="InterPro:IPR025284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF00"
FT                   /protein_id="CAI85436.1"
FT                   /translation="MSYPKIIIYNNEIELAEQPDEVDDFVYAMDELQKSRIIILDSKYS
FT                   YTTLSGEPKTAISAIELADLVKDYLLKEGQCCLSKIKQLTPEQAFALLIID"
     MSYPKIIIYN NEIELAEQPD EVDDFVYAMD ELQKSRIIIL DSKYSYTTLS GEPKTAISAI        60
     ELADLVKDYL LKEGQCCLSK IKQLTPEQAF ALLIID                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page