(data stored in ACNUC7421 zone)

EMBL: CR954246.PE323

CR954246.PE323       Location/Qualifiers
FT   CDS             349919..352447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0338"
FT                   /product="conserved protein of unknown function; putative
FT                   signaling protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85437"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ9"
FT                   /protein_id="CAI85437.1"
FT                   /translation="MPHSSRFQKVGDIFTNKVITCSKHTPLIDAVKLMRAHNISAIFIA
FT                   QQQRILGVWTETDCLKLDFTNPAVTSTSIKDVMTSPVLSVPSQQLLSDTALTFHQHGVR
FT                   HLLVTDNNNVPCGVISITDIVRNQGLDHYLQFRTINDQYTKNITIVPSSLALNEAVKLM
FT                   RERSEKVILVFNQQQKEHGIITQRDLLQLITRQSEQSVCWDLASRPLYKITPQDSLFDA
FT                   YKLMLDSQVRHLVVSDKDEIKGVLSLEHLIHEIESAYCSELEKVLVQRDLALQHSQRNL
FT                   YLANKIIDSSLDGIMITHSNSTIMQVNPAFTQLTGYKEHEVIGKCPSILSSGRHDKSFY
FT                   IKMWDAINKTGVWQGEICNRKKNGDIYIEWLTIIEIKEPNNSDAIYAAIFSDITERKNA
FT                   EDKIVQLAYFDELTGLPNRRLFNDRLKMALAAAHRDQHLLAVMFIDLDRFKEVNDSLGH
FT                   SAGDCLLTLVAARIEATLNEGDTLARLGGDEFVVLCEINKIDAVASLADKILNNLNSPF
FT                   QLDHVEVGVTASIGAAVYPDDGLDSETLLKHADIAMYRSKDVGRNSFQLFKPSMNARSL
FT                   ERLAMMSRFQHALDNNEFELYFQPKQCLKSEQIMGVEALLRWHDPDLGMISPAQFIPLA
FT                   EELGLIVRLDLWVINQAGKVLTLWQKEGLVAGRLAINISACHLSQGKLANNIGTMLKHY
FT                   NLPGSLLEIELTESSFISSFTQAKTQLQQLKKLGVHIALDDFGTGYSALSYLTKLPFDT
FT                   LKIDASFIAKIPDEYGNSQIVAALIALASNLNLMVVAEGVEQPAQKNYLISLGCNVIQG
FT                   YYYCRPLTQRQWFDFYRLNDLSASTQPTGT"
     MPHSSRFQKV GDIFTNKVIT CSKHTPLIDA VKLMRAHNIS AIFIAQQQRI LGVWTETDCL        60
     KLDFTNPAVT STSIKDVMTS PVLSVPSQQL LSDTALTFHQ HGVRHLLVTD NNNVPCGVIS       120
     ITDIVRNQGL DHYLQFRTIN DQYTKNITIV PSSLALNEAV KLMRERSEKV ILVFNQQQKE       180
     HGIITQRDLL QLITRQSEQS VCWDLASRPL YKITPQDSLF DAYKLMLDSQ VRHLVVSDKD       240
     EIKGVLSLEH LIHEIESAYC SELEKVLVQR DLALQHSQRN LYLANKIIDS SLDGIMITHS       300
     NSTIMQVNPA FTQLTGYKEH EVIGKCPSIL SSGRHDKSFY IKMWDAINKT GVWQGEICNR       360
     KKNGDIYIEW LTIIEIKEPN NSDAIYAAIF SDITERKNAE DKIVQLAYFD ELTGLPNRRL       420
     FNDRLKMALA AAHRDQHLLA VMFIDLDRFK EVNDSLGHSA GDCLLTLVAA RIEATLNEGD       480
     TLARLGGDEF VVLCEINKID AVASLADKIL NNLNSPFQLD HVEVGVTASI GAAVYPDDGL       540
     DSETLLKHAD IAMYRSKDVG RNSFQLFKPS MNARSLERLA MMSRFQHALD NNEFELYFQP       600
     KQCLKSEQIM GVEALLRWHD PDLGMISPAQ FIPLAEELGL IVRLDLWVIN QAGKVLTLWQ       660
     KEGLVAGRLA INISACHLSQ GKLANNIGTM LKHYNLPGSL LEIELTESSF ISSFTQAKTQ       720
     LQQLKKLGVH IALDDFGTGY SALSYLTKLP FDTLKIDASF IAKIPDEYGN SQIVAALIAL       780
     ASNLNLMVVA EGVEQPAQKN YLISLGCNVI QGYYYCRPLT QRQWFDFYRL NDLSASTQPT       840
     GT                                                                      842
//

If you have problems or comments...

PBIL Back to PBIL home page