(data stored in ACNUC7421 zone)

EMBL: CR954246.PE324

CR954246.PE324       Location/Qualifiers
FT   CDS             complement(352444..353253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0339"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85438"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ8"
FT                   /protein_id="CAI85438.1"
FT                   /translation="MQGTLRKLKSSLTEPVQYHLPVGEHLVDLNAFIGKELTLTFSGTI
FT                   LCSSCGKKTKKSYSQGHCFVCMRKLASCDMCIMKPETCHYDQGTCREPEWGEENCMIPH
FT                   YVYLANTSGLKVGITRHTQIPTRWVDQGATQALPIFKVQTRLQSGLVEVALAEFIADKT
FT                   NWRNMLKGQNEALDLKAAAAELIPQISAKLNELSELFGATAIEQLDEDVVDLNFPVSEY
FT                   PTKISSFNFDKDPVVSGVLQGIKGQYLIFEKGVINIRKFTSYEVTVG"
     MQGTLRKLKS SLTEPVQYHL PVGEHLVDLN AFIGKELTLT FSGTILCSSC GKKTKKSYSQ        60
     GHCFVCMRKL ASCDMCIMKP ETCHYDQGTC REPEWGEENC MIPHYVYLAN TSGLKVGITR       120
     HTQIPTRWVD QGATQALPIF KVQTRLQSGL VEVALAEFIA DKTNWRNMLK GQNEALDLKA       180
     AAAELIPQIS AKLNELSELF GATAIEQLDE DVVDLNFPVS EYPTKISSFN FDKDPVVSGV       240
     LQGIKGQYLI FEKGVINIRK FTSYEVTVG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page