(data stored in ACNUC7421 zone)

EMBL: CR954246.PE326

CR954246.PE326       Location/Qualifiers
FT   CDS             complement(353505..354671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0341"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85440"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEZ6"
FT                   /protein_id="CAI85440.1"
FT                   /translation="MVQYAGNCRFLWNKALAINLFKLQNKQKICYYQELDFFSKLWKKS
FT                   EEYGFLTLSPAQTIQQTLKQLERAFKDAFDKNQPLKRMPTFKKKGEVNSFNFPQGFKID
FT                   KNGKRIFLPKIGWVNVRKSQAILGKAKNVTVSQKGKHWFVSIQVEQEVAPPKHSSNAMI
FT                   GGDLGVKRLITLSDGSFVEPIDTSKQTIRIKRLQKQLARKVKFSSNWKKLKAKITTFHT
FT                   KVANIRHDKLHKISTQLSKSHAIIVLEDLKIRNMTKNSKGSSEQHGKMVKQKSGLNRVI
FT                   LNQGWGMFKEMLKYKQDWLGGQVIFVDPKHTSQTCPACGHQSKDNRLTQSKFECAKCGY
FT                   QDNADHVGALNILARGHRVLACGEIDISQLVEAGTCLMSDHKAPMVLN"
     MVQYAGNCRF LWNKALAINL FKLQNKQKIC YYQELDFFSK LWKKSEEYGF LTLSPAQTIQ        60
     QTLKQLERAF KDAFDKNQPL KRMPTFKKKG EVNSFNFPQG FKIDKNGKRI FLPKIGWVNV       120
     RKSQAILGKA KNVTVSQKGK HWFVSIQVEQ EVAPPKHSSN AMIGGDLGVK RLITLSDGSF       180
     VEPIDTSKQT IRIKRLQKQL ARKVKFSSNW KKLKAKITTF HTKVANIRHD KLHKISTQLS       240
     KSHAIIVLED LKIRNMTKNS KGSSEQHGKM VKQKSGLNRV ILNQGWGMFK EMLKYKQDWL       300
     GGQVIFVDPK HTSQTCPACG HQSKDNRLTQ SKFECAKCGY QDNADHVGAL NILARGHRVL       360
     ACGEIDISQL VEAGTCLMSD HKAPMVLN                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page