(data stored in ACNUC7421 zone)

EMBL: CR954246.PE328

CR954246.PE328       Location/Qualifiers
FT   CDS             complement(356321..357145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0344"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85442"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC4"
FT                   /protein_id="CAI85442.1"
FT                   /translation="MKFALKSILVATIALSSAASLAHNHSENSLVANALNDEQRAAKNS
FT                   ERDKFRHPAQTLAFFGLKPNMSVVEISPGGGWYSEILAPVLKDNGKFYAAHFPKDATGF
FT                   YQRSRSEFEQKVTQDPRFSKVIVTEFAPVTHTELAPANSADMVLTFRNVHNWYMGKNKD
FT                   GALSAFKSFYTALKPGGTLGVVEHRLPEARADDDQKSSGYMKQSYVIEIAKQAGFELVA
FT                   SSEINANPKDTADHPKGVWTLPPSLRLGEQDADKYKAIGESDRMTLKFKKPL"
     MKFALKSILV ATIALSSAAS LAHNHSENSL VANALNDEQR AAKNSERDKF RHPAQTLAFF        60
     GLKPNMSVVE ISPGGGWYSE ILAPVLKDNG KFYAAHFPKD ATGFYQRSRS EFEQKVTQDP       120
     RFSKVIVTEF APVTHTELAP ANSADMVLTF RNVHNWYMGK NKDGALSAFK SFYTALKPGG       180
     TLGVVEHRLP EARADDDQKS SGYMKQSYVI EIAKQAGFEL VASSEINANP KDTADHPKGV       240
     WTLPPSLRLG EQDADKYKAI GESDRMTLKF KKPL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page