(data stored in ACNUC7421 zone)

EMBL: CR954246.PE33

CR954246.PE33        Location/Qualifiers
FT   CDS             complement(34002..34541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0033"
FT                   /product="putative carbonic anhydrase/acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85147"
FT                   /db_xref="GOA:Q3IDI4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI4"
FT                   /protein_id="CAI85147.1"
FT                   /translation="MTIRSYKGVIPSFNASVYIDESSVLVGDITLGDDSSVWPLVAARG
FT                   DVNYIRIGERTNIQDGSVLHLSRATKSNPEGYPLIIGDDVTVGHKVMLHGCQLGNRILV
FT                   GMGAIIMDNAIVEDNVIIGGGSLVPPNKRLESGYLYVGSPVKQARALTEQELTFLKVSA
FT                   DNYVLLKNEYLSDDVI"
     MTIRSYKGVI PSFNASVYID ESSVLVGDIT LGDDSSVWPL VAARGDVNYI RIGERTNIQD        60
     GSVLHLSRAT KSNPEGYPLI IGDDVTVGHK VMLHGCQLGN RILVGMGAII MDNAIVEDNV       120
     IIGGGSLVPP NKRLESGYLY VGSPVKQARA LTEQELTFLK VSADNYVLLK NEYLSDDVI        179
//

If you have problems or comments...

PBIL Back to PBIL home page