(data stored in ACNUC7421 zone)

EMBL: CR954246.PE335

CR954246.PE335       Location/Qualifiers
FT   CDS             complement(365785..366189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0351"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85449"
FT                   /db_xref="GOA:Q3IIB7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB7"
FT                   /protein_id="CAI85449.1"
FT                   /translation="MRAKDKLRLNPIRMVLAEVMKREKDEQITLDDAGITSVIVKLVKQ
FT                   RRDSYTQYKDAGRDDLADIEANEIVALETFLPQKLSEEEIIALIDAAIADTNAAGMQDM
FT                   GKVMGIIKSKAEGRADMGKISGLIKQRLTA"
     MRAKDKLRLN PIRMVLAEVM KREKDEQITL DDAGITSVIV KLVKQRRDSY TQYKDAGRDD        60
     LADIEANEIV ALETFLPQKL SEEEIIALID AAIADTNAAG MQDMGKVMGI IKSKAEGRAD       120
     MGKISGLIKQ RLTA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page