(data stored in ACNUC7421 zone)

EMBL: CR954246.PE337

CR954246.PE337       Location/Qualifiers
FT   CDS             complement(366612..367217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0353"
FT                   /product="putative enzyme with N-6 Adenine-specific DNA
FT                   methylase domain"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85451"
FT                   /db_xref="GOA:Q3IIB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB5"
FT                   /protein_id="CAI85451.1"
FT                   /translation="MRKKTTQNKVTSKSSDGFIRVISGQFRGRKLPVKDVQGLRPTTDR
FT                   IKETVFNWLMQDTREANVLDCFAGSGGLGFEALSRFAKSATFVELDAAAAKQIELNIST
FT                   LKLQNAHVKHTNTLAFLEQINSNEPFNLVFVDPPFRKNLAQSSADLLENNQWLSSDALI
FT                   YIEVESELSTFTAPINWLLIKEKKAGQVFCRLYQRQVN"
     MRKKTTQNKV TSKSSDGFIR VISGQFRGRK LPVKDVQGLR PTTDRIKETV FNWLMQDTRE        60
     ANVLDCFAGS GGLGFEALSR FAKSATFVEL DAAAAKQIEL NISTLKLQNA HVKHTNTLAF       120
     LEQINSNEPF NLVFVDPPFR KNLAQSSADL LENNQWLSSD ALIYIEVESE LSTFTAPINW       180
     LLIKEKKAGQ VFCRLYQRQV N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page