(data stored in ACNUC7421 zone)

EMBL: CR954246.PE34

CR954246.PE34        Location/Qualifiers
FT   CDS             40991..41923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0038"
FT                   /product="putative lipoprotein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85148"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ46"
FT                   /protein_id="CAI85148.1"
FT                   /translation="MSNIKAWKLLSLFCLFAVLMGCQSKEEQLQKTIQESIKKAEVELS
FT                   QLGTALDNGSLRNALLLKEYGVQLKNQQPELSKVVDVITLDATRQGALYSGLTQRLKDI
FT                   KGTYLIPPYEDTLHSIDLLREAAKPTLFSDALTDPINMLADMSKGNLARIGAISQQAEG
FT                   AGVGNQMVGNPNYGNWQSNSNGTSFWQWYGMYRILGDVFNRVEYGSWSRGRKYSYYNDY
FT                   GRTRYSSPKQIKAQSTLETRTRQSYQRQGKQFTSPYASKKTGASGLSRSSYTPPKSRSS
FT                   YSRSSSYSNNSGSVRNSGSRTSRGVSRGK"
     MSNIKAWKLL SLFCLFAVLM GCQSKEEQLQ KTIQESIKKA EVELSQLGTA LDNGSLRNAL        60
     LLKEYGVQLK NQQPELSKVV DVITLDATRQ GALYSGLTQR LKDIKGTYLI PPYEDTLHSI       120
     DLLREAAKPT LFSDALTDPI NMLADMSKGN LARIGAISQQ AEGAGVGNQM VGNPNYGNWQ       180
     SNSNGTSFWQ WYGMYRILGD VFNRVEYGSW SRGRKYSYYN DYGRTRYSSP KQIKAQSTLE       240
     TRTRQSYQRQ GKQFTSPYAS KKTGASGLSR SSYTPPKSRS SYSRSSSYSN NSGSVRNSGS       300
     RTSRGVSRGK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page