(data stored in ACNUC7421 zone)

EMBL: CR954246.PE342

CR954246.PE342       Location/Qualifiers
FT   CDS             complement(372508..373344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0358"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85456"
FT                   /db_xref="GOA:Q3IIB0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB0"
FT                   /protein_id="CAI85456.1"
FT                   /translation="MIKDILLHPVLISVVVLTIAFSLKVLVDKLARYRAEKKEKDTRYI
FT                   AHNIKHFINFTMVLLLLFIWSTEIQNFALSIAAFAVAIVLATREFIQCVIGFFYLVTTR
FT                   PFRIGDWVQVGEYYGEVAETNWIKTTLHEIDMRTYQFSRKTIFIPNNKLITSPIKNLNF
FT                   VKRFATHHFNIVRKDSFNPYPIYETLRNKAKHYCEEFEEVASRYNSIIERKLDAKISGP
FT                   EPEIHFGTTELGEFRASFTLFCPTDKALEIEHKLTECFMELWYSEATKSDVQSKIT"
     MIKDILLHPV LISVVVLTIA FSLKVLVDKL ARYRAEKKEK DTRYIAHNIK HFINFTMVLL        60
     LLFIWSTEIQ NFALSIAAFA VAIVLATREF IQCVIGFFYL VTTRPFRIGD WVQVGEYYGE       120
     VAETNWIKTT LHEIDMRTYQ FSRKTIFIPN NKLITSPIKN LNFVKRFATH HFNIVRKDSF       180
     NPYPIYETLR NKAKHYCEEF EEVASRYNSI IERKLDAKIS GPEPEIHFGT TELGEFRASF       240
     TLFCPTDKAL EIEHKLTECF MELWYSEATK SDVQSKIT                               278
//

If you have problems or comments...

PBIL Back to PBIL home page