(data stored in ACNUC7421 zone)

EMBL: CR954246.PE343

CR954246.PE343       Location/Qualifiers
FT   CDS             complement(373436..374068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0359"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85457"
FT                   /db_xref="GOA:Q3IIA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA9"
FT                   /protein_id="CAI85457.1"
FT                   /translation="MFLLRSLIYLLCLAGVASLIQLEGFELQQNALYSEETLTEHMQDI
FT                   LTFLSAILFFYASRISPKLKVASVLLAALTAMMFVREFDTYLDMYVFDGAWQTIVYSIL
FT                   ACTFVYLIRKRGTIFSSIQAYTQTPSYGICLSGLVTLLAFSRIMGRGEFWHSIMGESYV
FT                   RIVKNIVEEGIETLGYTLILISAIELILLCRKQLNKQHHHVGNGVTD"
     MFLLRSLIYL LCLAGVASLI QLEGFELQQN ALYSEETLTE HMQDILTFLS AILFFYASRI        60
     SPKLKVASVL LAALTAMMFV REFDTYLDMY VFDGAWQTIV YSILACTFVY LIRKRGTIFS       120
     SIQAYTQTPS YGICLSGLVT LLAFSRIMGR GEFWHSIMGE SYVRIVKNIV EEGIETLGYT       180
     LILISAIELI LLCRKQLNKQ HHHVGNGVTD                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page