(data stored in ACNUC7421 zone)

EMBL: CR954246.PE346

CR954246.PE346       Location/Qualifiers
FT   CDS             378159..378917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0362"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85460"
FT                   /db_xref="GOA:Q3IIA6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIA6"
FT                   /protein_id="CAI85460.1"
FT                   /translation="MVIKCAFKECRPYLNELETRFGLAHWADQSSGFSLHYDDTGLSLY
FT                   KTDEPKLGAISVDFVTGAAAHRRKFGGGKGQAIAKAVGLNKGATPIVLDATAGLGRDGF
FT                   VLASLGCKVILHERHPVVAALLYDGLQRAYNDIEIGPWMQQNMSLIFGSSHTLLAQCES
FT                   MPDVVYLDPMFPHREKSALVKKEMRVFQDLVGADTDADDLLEFAYPLASKRVVVKRPDY
FT                   APFLNDKTPSMQIKTKKNRFDVYVKAAMKK"
     MVIKCAFKEC RPYLNELETR FGLAHWADQS SGFSLHYDDT GLSLYKTDEP KLGAISVDFV        60
     TGAAAHRRKF GGGKGQAIAK AVGLNKGATP IVLDATAGLG RDGFVLASLG CKVILHERHP       120
     VVAALLYDGL QRAYNDIEIG PWMQQNMSLI FGSSHTLLAQ CESMPDVVYL DPMFPHREKS       180
     ALVKKEMRVF QDLVGADTDA DDLLEFAYPL ASKRVVVKRP DYAPFLNDKT PSMQIKTKKN       240
     RFDVYVKAAM KK                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page