(data stored in ACNUC7421 zone)

EMBL: CR954246.PE347

CR954246.PE347       Location/Qualifiers
FT   CDS             complement(379115..379855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0363"
FT                   /product="conserved protein of unknown function ; putative
FT                   signal peptide"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85461"
FT                   /db_xref="GOA:Q3IIA5"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA5"
FT                   /protein_id="CAI85461.1"
FT                   /translation="MKVIIGLILMLGFASLNAKAKQIAIVIDDIGYHQRDLELLTLPGQ
FT                   VSYSILPHTPYAQAFATLASKTNKELLLHIPMQALNGKELGPGALTLNMNKEQIQQILG
FT                   TALASLPQVKGVNNHMGSALTQQSQAMRWIMEVLKKRHLYFLDSRTTELSQAQNAANFL
FT                   GVENIGRHIFLDNITTPEQLQLRLDELKQHATEHKFAIAIAHPYPETIAFLRHVLPQLS
FT                   KQGFELVPVSKLVERKYIQLAEKY"
     MKVIIGLILM LGFASLNAKA KQIAIVIDDI GYHQRDLELL TLPGQVSYSI LPHTPYAQAF        60
     ATLASKTNKE LLLHIPMQAL NGKELGPGAL TLNMNKEQIQ QILGTALASL PQVKGVNNHM       120
     GSALTQQSQA MRWIMEVLKK RHLYFLDSRT TELSQAQNAA NFLGVENIGR HIFLDNITTP       180
     EQLQLRLDEL KQHATEHKFA IAIAHPYPET IAFLRHVLPQ LSKQGFELVP VSKLVERKYI       240
     QLAEKY                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page