(data stored in ACNUC7421 zone)

EMBL: CR954246.PE348

CR954246.PE348       Location/Qualifiers
FT   CDS             complement(379928..381193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0364"
FT                   /product="putative carboxyl-terminal protease"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.102"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85462"
FT                   /db_xref="GOA:Q3IIA4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA4"
FT                   /protein_id="CAI85462.1"
FT                   /translation="MDKKSTVAKWFKNTGFTLNLSLYLLALFVFISFSANVFSSSIKEL
FT                   KSQQITEILFNIHTYYVEDLALQNTTHTSYNNQQFAHLYAQLDPYSKYLDEHELNALFD
FT                   NTNGRYTGLGIEVKQINNNVTIVNVVNNSPAKSAGVMAGDIIINVNNQTTQHSSVEHVA
FT                   QLITASKLSNISLTIKRDNQPQPLNFNVSRRKIKLESVTSQRLDLGCGYLAINSFSNHT
FT                   LHEVALQIAAMQNHFGDPLKGLVIDLRDNPGGTLRSAVAVSDLFLQNGTIVTTKGRYNE
FT                   ANKAFYAKHGDILKGAPIVVLINENSASAAEILAAALKDNNRAKVVGSQSFGKGSVQSL
FT                   IPLGDGSTALKLTTAKYFTPLGKSIEGVGITPDVAINQTTLSQSDKAVIIKNQQAKSKQ
FT                   TQLASKVTDLQLAKAKQLLNLQ"
     MDKKSTVAKW FKNTGFTLNL SLYLLALFVF ISFSANVFSS SIKELKSQQI TEILFNIHTY        60
     YVEDLALQNT THTSYNNQQF AHLYAQLDPY SKYLDEHELN ALFDNTNGRY TGLGIEVKQI       120
     NNNVTIVNVV NNSPAKSAGV MAGDIIINVN NQTTQHSSVE HVAQLITASK LSNISLTIKR       180
     DNQPQPLNFN VSRRKIKLES VTSQRLDLGC GYLAINSFSN HTLHEVALQI AAMQNHFGDP       240
     LKGLVIDLRD NPGGTLRSAV AVSDLFLQNG TIVTTKGRYN EANKAFYAKH GDILKGAPIV       300
     VLINENSASA AEILAAALKD NNRAKVVGSQ SFGKGSVQSL IPLGDGSTAL KLTTAKYFTP       360
     LGKSIEGVGI TPDVAINQTT LSQSDKAVII KNQQAKSKQT QLASKVTDLQ LAKAKQLLNL       420
     Q                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page