(data stored in ACNUC7421 zone)

EMBL: CR954246.PE349

CR954246.PE349       Location/Qualifiers
FT   CDS             complement(381262..382404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0365"
FT                   /product="conserved protein of unknown function ; putative
FT                   protease"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12113939"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85463"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE5"
FT                   /protein_id="CAI85463.1"
FT                   /translation="MQKCINSVTKLILILTFLATATAVANEDRTKKDLSEVQTALKQSQ
FT                   SEYNAQRKKVATLQKNLQQHELDIAKNAKALNMAEQSIKKTEQQQQLQQQKADQLEQQH
FT                   AQFQHALAAQLKSAYMAGGDDDYAKMLLNQEDTAKFERTLSYYNYLNKARIEQLEELKA
FT                   LQLQIAQNQAELAKTKQKLVNLHDEQKRRQTALVNAQSERQANLKNLQAQLNSTKSSIN
FT                   YLKENQQTLITTIEELEKEKNKKVELLGLNNSKGKLNWPSRGKLEHTFGQRKHGGIDWK
FT                   GVLIGAKEGSNINSVHNGQVVFADWLKGYGWVIVVDHGEGFMSLYGHAQTLLKDVGDMV
FT                   REGETVALVGQSGGQASSGLYFEMRHKGRAVNPEKWCKRI"
     MQKCINSVTK LILILTFLAT ATAVANEDRT KKDLSEVQTA LKQSQSEYNA QRKKVATLQK        60
     NLQQHELDIA KNAKALNMAE QSIKKTEQQQ QLQQQKADQL EQQHAQFQHA LAAQLKSAYM       120
     AGGDDDYAKM LLNQEDTAKF ERTLSYYNYL NKARIEQLEE LKALQLQIAQ NQAELAKTKQ       180
     KLVNLHDEQK RRQTALVNAQ SERQANLKNL QAQLNSTKSS INYLKENQQT LITTIEELEK       240
     EKNKKVELLG LNNSKGKLNW PSRGKLEHTF GQRKHGGIDW KGVLIGAKEG SNINSVHNGQ       300
     VVFADWLKGY GWVIVVDHGE GFMSLYGHAQ TLLKDVGDMV REGETVALVG QSGGQASSGL       360
     YFEMRHKGRA VNPEKWCKRI                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page