(data stored in ACNUC7421 zone)

EMBL: CR954246.PE35

CR954246.PE35        Location/Qualifiers
FT   CDS             41950..42849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0039"
FT                   /product="conserved protein of unknown function , putative
FT                   integral inner membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85149"
FT                   /db_xref="GOA:Q3IJ45"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ45"
FT                   /protein_id="CAI85149.1"
FT                   /translation="MYEFNGITMWSLQALAIDFAIIVLLFVSLKYIKGWVSNLHANDEI
FT                   TERDNFAFGISFAAGLVALAIVLTGVSSGAFAVSLQQEALQMLGYGALAILLIKLGHFF
FT                   QDKVALRKVSLHSEIVKGNVTAAVIDFGHVVSVAIVIRSALLWVATDGWHGLPIVVAAF
FT                   VIGSLVLLLVSQYRVQLFKRTNKSGDCLQQAIIDGNLAVGIRYAGFLIGSALAITAATG
FT                   IAPYVADNINASLLYWAISAVVSLLVFIILHLVTIKIILSGCDISDEVNRQKNVGVAAI
FT                   SAALSFAVGITMATLLGA"
     MYEFNGITMW SLQALAIDFA IIVLLFVSLK YIKGWVSNLH ANDEITERDN FAFGISFAAG        60
     LVALAIVLTG VSSGAFAVSL QQEALQMLGY GALAILLIKL GHFFQDKVAL RKVSLHSEIV       120
     KGNVTAAVID FGHVVSVAIV IRSALLWVAT DGWHGLPIVV AAFVIGSLVL LLVSQYRVQL       180
     FKRTNKSGDC LQQAIIDGNL AVGIRYAGFL IGSALAITAA TGIAPYVADN INASLLYWAI       240
     SAVVSLLVFI ILHLVTIKII LSGCDISDEV NRQKNVGVAA ISAALSFAVG ITMATLLGA        299
//

If you have problems or comments...

PBIL Back to PBIL home page