(data stored in ACNUC7421 zone)

EMBL: CR954246.PE352

CR954246.PE352       Location/Qualifiers
FT   CDS             385042..385311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0368"
FT                   /product="glutaredoxin 3 GrxC"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="3.3.8 : Protein repair"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11741965; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85466"
FT                   /db_xref="GOA:Q3IIE2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIE2"
FT                   /protein_id="CAI85466.1"
FT                   /translation="MSNVVLYTKAYCPFCQRARALLDSKGVQYTNFDIGVQPELRDEMI
FT                   AKAGGASTVPQIFINDEHIGGCDDMMAIEAQGQLDKKLNATLNA"
     MSNVVLYTKA YCPFCQRARA LLDSKGVQYT NFDIGVQPEL RDEMIAKAGG ASTVPQIFIN        60
     DEHIGGCDDM MAIEAQGQLD KKLNATLNA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page