(data stored in ACNUC7421 zone)

EMBL: CR954246.PE355

CR954246.PE355       Location/Qualifiers
FT   CDS             complement(387032..387496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0371"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85469"
FT                   /db_xref="GOA:Q3IID9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID9"
FT                   /protein_id="CAI85469.1"
FT                   /translation="MLDIVLYQPEIPPNTGNIIRLCANTGYSLHLIEPLGFAWDDKRIK
FT                   RAGLDYHEFSHVQRHASFEAYLEACKPKKIYACTTKGSQFHHQAQYEAGDCLVFGPETR
FT                   GLPDELIQSLPNEQRVRIPMQANSRSMNLSNAVSVFVYESWRQLGFPGAK"
     MLDIVLYQPE IPPNTGNIIR LCANTGYSLH LIEPLGFAWD DKRIKRAGLD YHEFSHVQRH        60
     ASFEAYLEAC KPKKIYACTT KGSQFHHQAQ YEAGDCLVFG PETRGLPDEL IQSLPNEQRV       120
     RIPMQANSRS MNLSNAVSVF VYESWRQLGF PGAK                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page