(data stored in ACNUC7421 zone)

EMBL: CR954246.PE356

CR954246.PE356       Location/Qualifiers
FT   CDS             387676..388524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0372"
FT                   /product="putative transport protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85470"
FT                   /db_xref="GOA:Q3IID8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID8"
FT                   /protein_id="CAI85470.1"
FT                   /translation="MIAAKTWAWLASGSASMLGSLTDSLMDITATAMSFLVLGYALRPA
FT                   DDDHRFGHGKAEALAGLGQAAFIAGSGCLLAFHSIERLFNPLELTHSLLGVWVSIFAIA
FT                   CTLVIVFVQNKVVKHTESIAIKADSVHYKGDLILNAAVLLAILLSYYGVLYADPIFAVG
FT                   VAGYLLYNSWDIARDSADHLMDKELPDEEKQRILDVSKSHIDVRGVHGVRTRQGGKVKF
FT                   IQLHLELDDHLSLIRAHNVADEVEAMITKEFESEVDILIHLDPLSSVELSDTEGAAVTE
FT                   A"
     MIAAKTWAWL ASGSASMLGS LTDSLMDITA TAMSFLVLGY ALRPADDDHR FGHGKAEALA        60
     GLGQAAFIAG SGCLLAFHSI ERLFNPLELT HSLLGVWVSI FAIACTLVIV FVQNKVVKHT       120
     ESIAIKADSV HYKGDLILNA AVLLAILLSY YGVLYADPIF AVGVAGYLLY NSWDIARDSA       180
     DHLMDKELPD EEKQRILDVS KSHIDVRGVH GVRTRQGGKV KFIQLHLELD DHLSLIRAHN       240
     VADEVEAMIT KEFESEVDIL IHLDPLSSVE LSDTEGAAVT EA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page