(data stored in ACNUC7421 zone)

EMBL: CR954246.PE357

CR954246.PE357       Location/Qualifiers
FT   CDS             complement(389162..390094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0373"
FT                   /product="putative lysophospholipase L(2)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.1.1.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3908445; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85471"
FT                   /db_xref="GOA:Q3IID7"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID7"
FT                   /protein_id="CAI85471.1"
FT                   /translation="MFYSSENELVNNQPSINDFYNNTLVKAYLNTPAGQLFYAYAKPEH
FT                   AHTAIVISSGRIEGLDKYKELLWELYTNNFAVFIVDHQGQGRSYRQLANKHKGYVKCFT
FT                   DYRHDLHLFNQQIVDNHWQGKKILLGHSMGGAIAFDYLAHFENNFSGLFLSAPMFDIHT
FT                   KNTPKPLAKLIANAAVFFGFSQSYALGQNDYNPEEFALNSLTSSQVRYKNFRQTYQDPL
FT                   LQLGGVTYGWLQAAFTFIASVDKLSINIPLFIASAERDEVVDNAAQYKLANRHNQAIIK
FT                   SFAGAKHELLFERDEIRQPLLTSLYQFCE"
     MFYSSENELV NNQPSINDFY NNTLVKAYLN TPAGQLFYAY AKPEHAHTAI VISSGRIEGL        60
     DKYKELLWEL YTNNFAVFIV DHQGQGRSYR QLANKHKGYV KCFTDYRHDL HLFNQQIVDN       120
     HWQGKKILLG HSMGGAIAFD YLAHFENNFS GLFLSAPMFD IHTKNTPKPL AKLIANAAVF       180
     FGFSQSYALG QNDYNPEEFA LNSLTSSQVR YKNFRQTYQD PLLQLGGVTY GWLQAAFTFI       240
     ASVDKLSINI PLFIASAERD EVVDNAAQYK LANRHNQAII KSFAGAKHEL LFERDEIRQP       300
     LLTSLYQFCE                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page