(data stored in ACNUC7421 zone)

EMBL: CR954246.PE358

CR954246.PE358       Location/Qualifiers
FT   CDS             complement(390098..391489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0374"
FT                   /product="putative sensor histidine kinase protein"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 3058985; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85472"
FT                   /db_xref="GOA:Q3IID6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID6"
FT                   /protein_id="CAI85472.1"
FT                   /translation="MASFSWLKHPRHYLFFKIFTWFWLTIIGTGAALIFLSSVTTINSV
FT                   SYNPLHGPMEKNLAYTAKNIERSTIKHKRSLNDTLKHPRRTNGKLLYLNAEQLEDSLTN
FT                   KSIPADVDLSLLNFTKSMPPQVIYTEKYQAIGPIKIRVPEGDFYLYEIDIYNHTPLYLR
FT                   LKLMPGWIKISIAIIASLILSFLFSRNLIAPINSLKKAAIKLSAGDLTARAAISVNRKD
FT                   ELGILGRDFNRMADQLAQLISAQKRLLADISHELRSPLTRLKMATGLAQMQANEASQSY
FT                   LLRIEKEANQLDKMIADVLQVSRLEANSQALSLHKQSLQDIVDHVLNDATFEAKQHNKQ
FT                   LQVSGSAAVTLNCDEALIASALENLLRNAIKYAQHTISLTLKHGDAIYIEICDDGPGVP
FT                   NNQLSKLCEPFFRQSDARDRVSGGTGLGLAIAKNAIIAHGGSLVLSNKPQGGLCAMVTL
FT                   PIIKE"
     MASFSWLKHP RHYLFFKIFT WFWLTIIGTG AALIFLSSVT TINSVSYNPL HGPMEKNLAY        60
     TAKNIERSTI KHKRSLNDTL KHPRRTNGKL LYLNAEQLED SLTNKSIPAD VDLSLLNFTK       120
     SMPPQVIYTE KYQAIGPIKI RVPEGDFYLY EIDIYNHTPL YLRLKLMPGW IKISIAIIAS       180
     LILSFLFSRN LIAPINSLKK AAIKLSAGDL TARAAISVNR KDELGILGRD FNRMADQLAQ       240
     LISAQKRLLA DISHELRSPL TRLKMATGLA QMQANEASQS YLLRIEKEAN QLDKMIADVL       300
     QVSRLEANSQ ALSLHKQSLQ DIVDHVLNDA TFEAKQHNKQ LQVSGSAAVT LNCDEALIAS       360
     ALENLLRNAI KYAQHTISLT LKHGDAIYIE ICDDGPGVPN NQLSKLCEPF FRQSDARDRV       420
     SGGTGLGLAI AKNAIIAHGG SLVLSNKPQG GLCAMVTLPI IKE                         463
//

If you have problems or comments...

PBIL Back to PBIL home page