(data stored in ACNUC7421 zone)

EMBL: CR954246.PE36

CR954246.PE36        Location/Qualifiers
FT   CDS             42854..44575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0040"
FT                   /product="putative spermine/spermidine synthase family
FT                   protein"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="2.5.1.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85150"
FT                   /db_xref="GOA:Q3IJ44"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ44"
FT                   /protein_id="CAI85150.1"
FT                   /translation="MSSTIKSPSKFSLLGHDILLITVMAVLAGCGLIYEYLLSHYAGRV
FT                   LGSVESAIYAMIGTMIVAMGIGAFLARWFKDAFTAFAWLESIIALIGMGCILAIAGVIA
FT                   VSYSLPHMFSSIFNLPPDVVLNGYVFQKLQEWSRFLPYVFGLILGLFIGMEIPLIARIR
FT                   QHVYGRFLENNAGTIYGADYIGAGIGAAIWVSIMLSMPIMQAAAWTALFNIIAGLAFLW
FT                   RYHTYVRFAKLLLACHLLLLVLFAFILVLGSSWMDNLSNVLYKDKVIYSQATKYQHVVL
FT                   TERLSKNQPQPITDLYLNGRLQFSSVDEQIYHSMLVYPAMLASNRHERVLIIGGGDGLA
FT                   LRDVLKWPVSKVTLIDLDGQLLNLFGHKDAEFTSPEDISQRLLSLNSKSMHDPRADIIV
FT                   GDAFLEVEKLLDQAKQFDTILIDLPDPNHPDLNKMYSDYFYNHVRQLLAPDGAMAVQST
FT                   SPYHAKKAFLSIAKTVKAAGFEYVEQYQQNIPSFGQWGWTIATKMGQSASGRINDVTAM
FT                   PIPSRWISKEYLLASFIFPNNYFEHIKDIEVNRLGSGQLYDYYRTAWQIESELYKN"
     MSSTIKSPSK FSLLGHDILL ITVMAVLAGC GLIYEYLLSH YAGRVLGSVE SAIYAMIGTM        60
     IVAMGIGAFL ARWFKDAFTA FAWLESIIAL IGMGCILAIA GVIAVSYSLP HMFSSIFNLP       120
     PDVVLNGYVF QKLQEWSRFL PYVFGLILGL FIGMEIPLIA RIRQHVYGRF LENNAGTIYG       180
     ADYIGAGIGA AIWVSIMLSM PIMQAAAWTA LFNIIAGLAF LWRYHTYVRF AKLLLACHLL       240
     LLVLFAFILV LGSSWMDNLS NVLYKDKVIY SQATKYQHVV LTERLSKNQP QPITDLYLNG       300
     RLQFSSVDEQ IYHSMLVYPA MLASNRHERV LIIGGGDGLA LRDVLKWPVS KVTLIDLDGQ       360
     LLNLFGHKDA EFTSPEDISQ RLLSLNSKSM HDPRADIIVG DAFLEVEKLL DQAKQFDTIL       420
     IDLPDPNHPD LNKMYSDYFY NHVRQLLAPD GAMAVQSTSP YHAKKAFLSI AKTVKAAGFE       480
     YVEQYQQNIP SFGQWGWTIA TKMGQSASGR INDVTAMPIP SRWISKEYLL ASFIFPNNYF       540
     EHIKDIEVNR LGSGQLYDYY RTAWQIESEL YKN                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page