(data stored in ACNUC7421 zone)

EMBL: CR954246.PE360

CR954246.PE360       Location/Qualifiers
FT   CDS             392345..392830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0376"
FT                   /product="conserved protein of unknown function ; putative
FT                   CpxP (P pilus assembly/Cpx signaling pathway, periplasmic
FT                   inhibitor/zinc-resistance associated) domain"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85474"
FT                   /db_xref="GOA:Q3IID4"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID4"
FT                   /protein_id="CAI85474.1"
FT                   /translation="MTKVNTLSKLVLICGLATATFGATSVMAKGDMHKQGRHSQAHFLL
FT                   SERGADKLDLTQEQQTKLEAIFAAQKTQMQALKGTDKESRKAQRTAHKAKMESLLSAAT
FT                   FDENAAKELLAQRHEKGEEMGLIKLKTQHQVWQVLNAEQQEKFAKMQKRMGKKKHSK"
     MTKVNTLSKL VLICGLATAT FGATSVMAKG DMHKQGRHSQ AHFLLSERGA DKLDLTQEQQ        60
     TKLEAIFAAQ KTQMQALKGT DKESRKAQRT AHKAKMESLL SAATFDENAA KELLAQRHEK       120
     GEEMGLIKLK TQHQVWQVLN AEQQEKFAKM QKRMGKKKHS K                           161
//

If you have problems or comments...

PBIL Back to PBIL home page