(data stored in ACNUC7421 zone)

EMBL: CR954246.PE366

CR954246.PE366       Location/Qualifiers
FT   CDS             398078..398689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0382"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein, putative fimbrial assembly protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85480"
FT                   /db_xref="GOA:Q3IIC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC8"
FT                   /protein_id="CAI85480.1"
FT                   /translation="MLKQKFKQKLQWSIIHLLTGALVLTIAAMLIYLNWFYDGRYLLTD
FT                   LVGLAVIIFTLDLILGPVLSFWLLSPNKTKKENVINILLIVLLQVVSFSYGVVQIDSQR
FT                   LAYIIKWQSSYFAVSKSESRRDEITEHFYNFNEPKVGTVNRSQYDKLIKESISPVEMYE
FT                   FFEEVSFATECGLQCAVITKKGIVNVTKNSNSLVFNKSLR"
     MLKQKFKQKL QWSIIHLLTG ALVLTIAAML IYLNWFYDGR YLLTDLVGLA VIIFTLDLIL        60
     GPVLSFWLLS PNKTKKENVI NILLIVLLQV VSFSYGVVQI DSQRLAYIIK WQSSYFAVSK       120
     SESRRDEITE HFYNFNEPKV GTVNRSQYDK LIKESISPVE MYEFFEEVSF ATECGLQCAV       180
     ITKKGIVNVT KNSNSLVFNK SLR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page