(data stored in ACNUC7421 zone)

EMBL: CR954246.PE367

CR954246.PE367       Location/Qualifiers
FT   CDS             complement(398670..399065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0383"
FT                   /product="putative Pilus biogenesis protein tapA precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85481"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC7"
FT                   /protein_id="CAI85481.1"
FT                   /translation="MITIAIMGILISLALPAYNNHYKRAKFTEVVLATNALQRNIEICF
FT                   YIKESLNNCNTFSKLGSNKSDFLAPEFISDIEITNTALSIQIKSTASNKASISSAGDTY
FT                   IMLATINVNQLQWELLATSTCINEGTC"
     MITIAIMGIL ISLALPAYNN HYKRAKFTEV VLATNALQRN IEICFYIKES LNNCNTFSKL        60
     GSNKSDFLAP EFISDIEITN TALSIQIKST ASNKASISSA GDTYIMLATI NVNQLQWELL       120
     ATSTCINEGT C                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page