(data stored in ACNUC7421 zone)

EMBL: CR954246.PE37

CR954246.PE37        Location/Qualifiers
FT   CDS             44655..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0041"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfI"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85151"
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF17"
FT                   /protein_id="CAI85151.1"
FT                   /translation="MELNELSIKLASFETEGANFESFLIANPGEQDVLQVIVDENDELP
FT                   IFVTQTQEQLLCISYLFDEDEVKPELRNELNETLLRLNVPIPLSAFAKIDNKYAIFGAL
FT                   SVNSSLDDITHELVTLADNAIDALEAVTMYLND"
     MELNELSIKL ASFETEGANF ESFLIANPGE QDVLQVIVDE NDELPIFVTQ TQEQLLCISY        60
     LFDEDEVKPE LRNELNETLL RLNVPIPLSA FAKIDNKYAI FGALSVNSSL DDITHELVTL       120
     ADNAIDALEA VTMYLND                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page