(data stored in ACNUC7421 zone)

EMBL: CR954246.PE373

CR954246.PE373       Location/Qualifiers
FT   CDS             402058..402909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0389"
FT                   /product="putative ampicillin resistance protein"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85487"
FT                   /db_xref="GOA:Q3III0"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III0"
FT                   /protein_id="CAI85487.1"
FT                   /translation="MILVSIIIALILERLGARSAHWQISYYADGYVNRSANLLTNKGVF
FT                   GSGVGFLVWLLLPVLAIGCLYLLSDFVLWQLIFNVTILLVCFGCAKQRALYKSYLNALT
FT                   RDDKTAATLYALQMGQNRTEEEQDGETVGQTLAWVNFRFYCAVIFWFVILGVAGAVLYA
FT                   LVRTFADLVTQDDDEIIAKHSKMLHRLLFWLDWLPARITSFGYLVIGNFNKGTSCWLRY
FT                   ALDFSSPNRKVVTYTALAAEQVEKRYYDCAYEATCMIKLVKRNVLFYLVLIALLTLFGG
FT                   LD"
     MILVSIIIAL ILERLGARSA HWQISYYADG YVNRSANLLT NKGVFGSGVG FLVWLLLPVL        60
     AIGCLYLLSD FVLWQLIFNV TILLVCFGCA KQRALYKSYL NALTRDDKTA ATLYALQMGQ       120
     NRTEEEQDGE TVGQTLAWVN FRFYCAVIFW FVILGVAGAV LYALVRTFAD LVTQDDDEII       180
     AKHSKMLHRL LFWLDWLPAR ITSFGYLVIG NFNKGTSCWL RYALDFSSPN RKVVTYTALA       240
     AEQVEKRYYD CAYEATCMIK LVKRNVLFYL VLIALLTLFG GLD                         283
//

If you have problems or comments...

PBIL Back to PBIL home page