(data stored in ACNUC7421 zone)

EMBL: CR954246.PE378

CR954246.PE378       Location/Qualifiers
FT   CDS             411183..411779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0394"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85492"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH5"
FT                   /protein_id="CAI85492.1"
FT                   /translation="MTRCQQCLLAELYCICEGVVQADCDAAVCLLMYHNESFKPSNTGR
FT                   LIAEIVPENYAFRWDRTDPDAKLLALINDPQYQPMVVFPAEDVEPGRAVTEVNITAGKK
FT                   PLFIFLDGTWREAKKMIRKSPYLDNLPVLSITADKLSDYRLRVAPHAHQLGTAEVAIMV
FT                   LALAGEKDAATKLEQHFIKFRDAYLLGKRNKGRPE"
     MTRCQQCLLA ELYCICEGVV QADCDAAVCL LMYHNESFKP SNTGRLIAEI VPENYAFRWD        60
     RTDPDAKLLA LINDPQYQPM VVFPAEDVEP GRAVTEVNIT AGKKPLFIFL DGTWREAKKM       120
     IRKSPYLDNL PVLSITADKL SDYRLRVAPH AHQLGTAEVA IMVLALAGEK DAATKLEQHF       180
     IKFRDAYLLG KRNKGRPE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page