(data stored in ACNUC7421 zone)

EMBL: CR954246.PE379

CR954246.PE379       Location/Qualifiers
FT   CDS             412176..413717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0395"
FT                   /product="putative aerotaxis sensory transducer"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12511500; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85493"
FT                   /db_xref="GOA:Q3IIH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH4"
FT                   /protein_id="CAI85493.1"
FT                   /translation="MSQQKQAIVDQEVTFGIDEELLSTTDLQGVITYANDNFCKVAGYT
FT                   LDELVGNNHSMVRHPDMPKAAFADLWSNLKNDIAWRGAIKNRCKNGQYYWVDAFVTPIY
FT                   ENGKKIGYQSVRRRLLPEYLNSAENLYKRINSGKSINTFTHKLSALKLPLYLCFSALFA
FT                   WLASYSLWFILLFIPLPFVIYYDQLVLSQRYLKKRKTESDSISRHVFSGSNIFSFADFQ
FT                   IKLLEGKVTTIVGRIIDGTLSLEKGANSLKAVAQKSKLGVEKEAAELHQVSSAVEQMVN
FT                   SIDEVAKSTVITTQKVNQAHSNCEAATQAMSQTMDKVSLLANEVDNSANSATELAKEAG
FT                   KIGDIMQEIQGIADQTNLLALNAAIEAARAGEHGRGFSVVADEVRALSSRTHSATEQIQ
FT                   TSIAEMQSTLLSWSKTMEVGKNAAEDCVKETRQTQEIVSQVHLSISDISDLTGQISTAA
FT                   EEQSMVSQEISRNIYNISETSSENLTQAQLVEVESDSIDKRSKMLASLGLSFKVD"
     MSQQKQAIVD QEVTFGIDEE LLSTTDLQGV ITYANDNFCK VAGYTLDELV GNNHSMVRHP        60
     DMPKAAFADL WSNLKNDIAW RGAIKNRCKN GQYYWVDAFV TPIYENGKKI GYQSVRRRLL       120
     PEYLNSAENL YKRINSGKSI NTFTHKLSAL KLPLYLCFSA LFAWLASYSL WFILLFIPLP       180
     FVIYYDQLVL SQRYLKKRKT ESDSISRHVF SGSNIFSFAD FQIKLLEGKV TTIVGRIIDG       240
     TLSLEKGANS LKAVAQKSKL GVEKEAAELH QVSSAVEQMV NSIDEVAKST VITTQKVNQA       300
     HSNCEAATQA MSQTMDKVSL LANEVDNSAN SATELAKEAG KIGDIMQEIQ GIADQTNLLA       360
     LNAAIEAARA GEHGRGFSVV ADEVRALSSR THSATEQIQT SIAEMQSTLL SWSKTMEVGK       420
     NAAEDCVKET RQTQEIVSQV HLSISDISDL TGQISTAAEE QSMVSQEISR NIYNISETSS       480
     ENLTQAQLVE VESDSIDKRS KMLASLGLSF KVD                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page