(data stored in ACNUC7421 zone)

EMBL: CR954246.PE38

CR954246.PE38        Location/Qualifiers
FT   CDS             45093..45785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0042"
FT                   /product="conserved protein of unknown function; similar to
FT                   E. coli YjfJ; could be a phage protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85152"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF16"
FT                   /protein_id="CAI85152.1"
FT                   /translation="MSILKKLFTAVRGGAREAGEAIVDKNGIRIFEQEIADAQNALHRA
FT                   KKSLTEVMAKEMQTKRKISAVDASIAEHEAYAGQALEKGNEALALEIAEKIGEFEAEKA
FT                   ENEQVLSGFSNHIVALKQQVKEAEKSIKENQRQLTMVKTTESVQQATMAVNSTLNTNSS
FT                   SMTSARQSLERIKQRQQDRQDQLGAAKELEADVNGDDLKAKMAEAGIGDSSPKSADILA
FT                   RIKAKQNS"
     MSILKKLFTA VRGGAREAGE AIVDKNGIRI FEQEIADAQN ALHRAKKSLT EVMAKEMQTK        60
     RKISAVDASI AEHEAYAGQA LEKGNEALAL EIAEKIGEFE AEKAENEQVL SGFSNHIVAL       120
     KQQVKEAEKS IKENQRQLTM VKTTESVQQA TMAVNSTLNT NSSSMTSARQ SLERIKQRQQ       180
     DRQDQLGAAK ELEADVNGDD LKAKMAEAGI GDSSPKSADI LARIKAKQNS                  230
//

If you have problems or comments...

PBIL Back to PBIL home page