(data stored in ACNUC7421 zone)

EMBL: CR954246.PE381

CR954246.PE381       Location/Qualifiers
FT   CDS             415431..416213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0397"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85495"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH2"
FT                   /protein_id="CAI85495.1"
FT                   /translation="MKLKLLSILVAATAATNAFADDAEQKTWEVTSELGAIITSGNTET
FT                   TTLKGGIKVLHHLERWNNEYKLDGIYKEDEVENDDGTKDKQRTNEKYAISAQGNYKLNE
FT                   KHSHLFIYGSHVSDYFGAYRSESVVSAGYGLRLLNEKTMWLNAEIGPGYKYFKYPDVST
FT                   EVDENGNSLAGEYEGEIIALGKLDYNWKISDNARFTQLVTVEYGDTNTKTRSETALLAK
FT                   INGSLQMKVAYNIINNSDVADDKESTDTETSLTLVYSF"
     MKLKLLSILV AATAATNAFA DDAEQKTWEV TSELGAIITS GNTETTTLKG GIKVLHHLER        60
     WNNEYKLDGI YKEDEVENDD GTKDKQRTNE KYAISAQGNY KLNEKHSHLF IYGSHVSDYF       120
     GAYRSESVVS AGYGLRLLNE KTMWLNAEIG PGYKYFKYPD VSTEVDENGN SLAGEYEGEI       180
     IALGKLDYNW KISDNARFTQ LVTVEYGDTN TKTRSETALL AKINGSLQMK VAYNIINNSD       240
     VADDKESTDT ETSLTLVYSF                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page