(data stored in ACNUC7421 zone)

EMBL: CR954246.PE382

CR954246.PE382       Location/Qualifiers
FT   CDS             416337..417320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0398"
FT                   /product="putative polysaccharide export family"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85496"
FT                   /db_xref="GOA:Q3IIH1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH1"
FT                   /protein_id="CAI85496.1"
FT                   /translation="MNVFKYFIAVFILACGFGALAFTPTNAQIEQFKKLPKSQQEALAK
FT                   QYGVDLSSIGNISQSNETAATEQSTVINQRAEERKEPLTDEERFQPEIEPVKPFGYELF
FT                   AGEPTTFMPNESAAVPDTYLIGRGDQLLINFYGKESDSFEVIVDREGRINIPDLSPVQV
FT                   AGLTFAEVKELIKVKVEQEIIGVKAFVSLGQLRSMRIMVLGEAYKPGSYSVSSLTTVSH
FT                   ALFVSGGVSDIASLRNIQVKRAGKVITNFDMYDLLINGDSSNDIILKPGDVVFIPTVGE
FT                   QVAVEGLVKRPAIFELLGMGGILTKNIPERMIFAGNPAKKLKEIVE"
     MNVFKYFIAV FILACGFGAL AFTPTNAQIE QFKKLPKSQQ EALAKQYGVD LSSIGNISQS        60
     NETAATEQST VINQRAEERK EPLTDEERFQ PEIEPVKPFG YELFAGEPTT FMPNESAAVP       120
     DTYLIGRGDQ LLINFYGKES DSFEVIVDRE GRINIPDLSP VQVAGLTFAE VKELIKVKVE       180
     QEIIGVKAFV SLGQLRSMRI MVLGEAYKPG SYSVSSLTTV SHALFVSGGV SDIASLRNIQ       240
     VKRAGKVITN FDMYDLLING DSSNDIILKP GDVVFIPTVG EQVAVEGLVK RPAIFELLGM       300
     GGILTKNIPE RMIFAGNPAK KLKEIVE                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page