(data stored in ACNUC7421 zone)

EMBL: CR954246.PE384

CR954246.PE384       Location/Qualifiers
FT   CDS             418169..419347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0400"
FT                   /product="putative aminotransferase, DegT/DnrJ/EryC1/StrS
FT                   family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85498"
FT                   /db_xref="GOA:Q3IIG9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG9"
FT                   /protein_id="CAI85498.1"
FT                   /translation="MLNTTFSPWPSFTQDEADAVSRVVLSNKVNYWTGTEGREFEKEFA
FT                   SWADSEYAIALGNGTLALDIALKALNVGSGDEVITTPRTFLASASSIVTAGAAPVFADV
FT                   DLNSQAITAASIKAVLTPKTKAVIVVHLAGMPAEMDSIMALSKEHGFYVIEDCAQAHGA
FT                   KYKGRSVGSIGHVGAWSFCQDKIMTTGGEGGIVTTNSKELWSIMWSYKDHGKSFDAIYN
FT                   REHPPGFRWLHESFGTNWRMTEMQAVLGRIQLTRMSDWTAKRQAYGAELDKAASEFDSI
FT                   RLVTVPSYIEHAEYKHYMFVKPEKLAEGWDRDRMVNEIVERGVPCFQGSCSEVYLEKAF
FT                   NNTPWRPDKRLPNAVELGETSLMFLVHPTLTEAEITKTTQVMKEVFSLASKS"
     MLNTTFSPWP SFTQDEADAV SRVVLSNKVN YWTGTEGREF EKEFASWADS EYAIALGNGT        60
     LALDIALKAL NVGSGDEVIT TPRTFLASAS SIVTAGAAPV FADVDLNSQA ITAASIKAVL       120
     TPKTKAVIVV HLAGMPAEMD SIMALSKEHG FYVIEDCAQA HGAKYKGRSV GSIGHVGAWS       180
     FCQDKIMTTG GEGGIVTTNS KELWSIMWSY KDHGKSFDAI YNREHPPGFR WLHESFGTNW       240
     RMTEMQAVLG RIQLTRMSDW TAKRQAYGAE LDKAASEFDS IRLVTVPSYI EHAEYKHYMF       300
     VKPEKLAEGW DRDRMVNEIV ERGVPCFQGS CSEVYLEKAF NNTPWRPDKR LPNAVELGET       360
     SLMFLVHPTL TEAEITKTTQ VMKEVFSLAS KS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page