(data stored in ACNUC7421 zone)

EMBL: CR954246.PE385

CR954246.PE385       Location/Qualifiers
FT   CDS             419833..421788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0401"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85499"
FT                   /db_xref="GOA:Q3IIG8"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG8"
FT                   /protein_id="CAI85499.1"
FT                   /translation="MDSFIRSIINAPRAKKRVITLFIDSLFIAAAFWLALIVRLDSLEP
FT                   LSVSGNWLLLALLIPISLYAFITLGLYRAVLRYMNSQAVWAIILGTLITTVSLVLLAFF
FT                   VGIEIPRTMPFIFAWLCLLTVGGSRIIVRALIGRMTTSNKDAVIIYGAGSSGRQLATAL
FT                   NAGPEYFVSAFIDDDVTKHGSIIQGIPVRAFNDIHALIKKRKATKVLLAMPSETRARRK
FT                   EVLAQLEPLTIKVLSIPGMADIVEGKAKLSEFRDVEIEDLLGRDPVTPKDDLMTVNITD
FT                   KVVMVTGAGGSIGSELCRQIIKLKPTKLVLFERSEIALYSIEKELGEYIISNTLNIELI
FT                   PIMGSVQRVNRLETVMRTFGVRTIYHAAAYKHVPLVEHNVVEGVRNNVFGTYYAAKAAV
FT                   EAKVDTFVLISTDKAVRPTNIMGATKRMAELVLQGLAQEQGAKHKTRFCMVRFGNVLGS
FT                   SGSVVPLFRRQIKEGGPITLTHPDITRYFMTIPEAAQLVIQAGAMGKGGDVFVLDMGDS
FT                   VKISDLATKMVRLSGLEIKTDDTPHGDIEIKCTGLRPGEKLYEELLIGDNVEQTSHERI
FT                   MTAKEVMLPLSELNVFIEALDIACHDFNHETIRQLLLDAPTGFNPTDGICDLVWNARLE
FT                   NKGNTESESNVVNLSK"
     MDSFIRSIIN APRAKKRVIT LFIDSLFIAA AFWLALIVRL DSLEPLSVSG NWLLLALLIP        60
     ISLYAFITLG LYRAVLRYMN SQAVWAIILG TLITTVSLVL LAFFVGIEIP RTMPFIFAWL       120
     CLLTVGGSRI IVRALIGRMT TSNKDAVIIY GAGSSGRQLA TALNAGPEYF VSAFIDDDVT       180
     KHGSIIQGIP VRAFNDIHAL IKKRKATKVL LAMPSETRAR RKEVLAQLEP LTIKVLSIPG       240
     MADIVEGKAK LSEFRDVEIE DLLGRDPVTP KDDLMTVNIT DKVVMVTGAG GSIGSELCRQ       300
     IIKLKPTKLV LFERSEIALY SIEKELGEYI ISNTLNIELI PIMGSVQRVN RLETVMRTFG       360
     VRTIYHAAAY KHVPLVEHNV VEGVRNNVFG TYYAAKAAVE AKVDTFVLIS TDKAVRPTNI       420
     MGATKRMAEL VLQGLAQEQG AKHKTRFCMV RFGNVLGSSG SVVPLFRRQI KEGGPITLTH       480
     PDITRYFMTI PEAAQLVIQA GAMGKGGDVF VLDMGDSVKI SDLATKMVRL SGLEIKTDDT       540
     PHGDIEIKCT GLRPGEKLYE ELLIGDNVEQ TSHERIMTAK EVMLPLSELN VFIEALDIAC       600
     HDFNHETIRQ LLLDAPTGFN PTDGICDLVW NARLENKGNT ESESNVVNLS K                651
//

If you have problems or comments...

PBIL Back to PBIL home page