(data stored in ACNUC7421 zone)

EMBL: CR954246.PE386

CR954246.PE386       Location/Qualifiers
FT   CDS             421985..422149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0402"
FT                   /product="putative orphan protein ; putative ISSod2,
FT                   transposase OrfA (partial)"
FT                   /function="4.5 : Transposons and ISs"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85500"
FT                   /db_xref="GOA:Q3IIG7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG7"
FT                   /protein_id="CAI85500.1"
FT                   /translation="MKKAHFTDSQILAILKQAKSGVPIPELCREHGMGNSTFYKWRAKC
FT                   VFNDAHGRA"
     MKKAHFTDSQ ILAILKQAKS GVPIPELCRE HGMGNSTFYK WRAKCVFNDA HGRA              54
//

If you have problems or comments...

PBIL Back to PBIL home page