(data stored in ACNUC7421 zone)

EMBL: CR954246.PE388

CR954246.PE388       Location/Qualifiers
FT   CDS             422231..422512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0404"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85502"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF4"
FT                   /protein_id="CAI85502.1"
FT                   /translation="MVKASERKVLAHKVVSTNKMSIALACRTFMISETCYRYTPILRNE
FT                   NLKIAKLLLDLTELKRSWGFGLCFLYLRNEKSTSGITSEFTAFTVILS"
     MVKASERKVL AHKVVSTNKM SIALACRTFM ISETCYRYTP ILRNENLKIA KLLLDLTELK        60
     RSWGFGLCFL YLRNEKSTSG ITSEFTAFTV ILS                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page