(data stored in ACNUC7421 zone)

EMBL: CR954246.PE389

CR954246.PE389       Location/Qualifiers
FT   CDS             422515..423060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0405"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /EC_number="2.7.7.49"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85503"
FT                   /db_xref="GOA:Q3IIG5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG5"
FT                   /protein_id="CAI85503.1"
FT                   /translation="MRIKPRKRLNRDKPEPLAVPETINECWSMDFMHDQLADGRACRLF
FT                   NVIDDFNREGLTIDADLSLPAERVIRSLNQIIEWRGKPKAIRCDNGPEYISKQLAQWAL
FT                   NNDIELRFIQPGNPQQNAYIERFNRTVRYDWLSHYIYSDISELQDRATDWLWTYNNERP
FT                   NMGLGGITPIQKLEKLNN"
     MRIKPRKRLN RDKPEPLAVP ETINECWSMD FMHDQLADGR ACRLFNVIDD FNREGLTIDA        60
     DLSLPAERVI RSLNQIIEWR GKPKAIRCDN GPEYISKQLA QWALNNDIEL RFIQPGNPQQ       120
     NAYIERFNRT VRYDWLSHYI YSDISELQDR ATDWLWTYNN ERPNMGLGGI TPIQKLEKLN       180
     N                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page