(data stored in ACNUC7421 zone)

EMBL: CR954246.PE39

CR954246.PE39        Location/Qualifiers
FT   CDS             45860..46498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0043"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85153"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF15"
FT                   /protein_id="CAI85153.1"
FT                   /translation="MFNFFKSKKEPERQLNHASELKKGDMFTVIDSFAYPAWLKGQTLR
FT                   VIDIQTYQYQHSSDTEFVLESDSGQVVFLQIEQEDGEQWANFSIKVQRDEVEDIFGLDQ
FT                   FARIFDEESLTHITVQNIPERFTQFLANSYQQSESPFVCYFHNKDYRNQALPRYEQEGG
FT                   ELCEMICLESDDKGFGLNIEIWDGGETEVSLTLTRPITDIVDLFPGDAK"
     MFNFFKSKKE PERQLNHASE LKKGDMFTVI DSFAYPAWLK GQTLRVIDIQ TYQYQHSSDT        60
     EFVLESDSGQ VVFLQIEQED GEQWANFSIK VQRDEVEDIF GLDQFARIFD EESLTHITVQ       120
     NIPERFTQFL ANSYQQSESP FVCYFHNKDY RNQALPRYEQ EGGELCEMIC LESDDKGFGL       180
     NIEIWDGGET EVSLTLTRPI TDIVDLFPGD AK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page