(data stored in ACNUC7421 zone)

EMBL: CR954246.PE390

CR954246.PE390       Location/Qualifiers
FT   CDS             423413..424981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0406"
FT                   /product="putative orphan protein ; putative
FT                   acyltransferase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85504"
FT                   /db_xref="GOA:Q3IIG4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG4"
FT                   /protein_id="CAI85504.1"
FT                   /translation="MIVNTPNESNQVVNQAIFGSTFISNIGFWLQNSYFSKAEFNPLLH
FT                   LWSLGVEIQFYLIVPILAWFFSKTRFSLVFIVIVSMALCFIVLTISPKTSFFMMPLRLW
FT                   EFLLGYGVALYLTQSGAVKFPKQSWLGFVGLILILLIPFFNVNGESLSIILGHPGAGAL
FT                   LVSIATSIVLVFGLPKIVEKNIISKGLAILGKYSYSIYLIHFPVIVLYLSEPFMGTILD
FT                   IPNVITFIIIFALIFTLSFTLHKLVETRNFNISITKLSVIFIALIIGLAIIGPWIKTNF
FT                   ISNQEKSIFNAFNDRSTYRCGKLIRITNPTTLTCNLSEDINDTVNKVMLVGNSHADSIK
FT                   TTFIKVAAKHNQAVYFIVQNNPLMAGGLSPDIVVREAISKEVKHIVVHFSPSGISVSKL
FT                   KELVFLAEKNSIKITFIDPVPVWESHIPKMMYRQLKGFNDNELQTKDDYLSFNNELFTE
FT                   VDNISNDNFKRISIADYFCTPNCSYKLEDGTPFYFDSGHLTLTGSNVIEKALNEAISAG
FT                   KYSEN"
     MIVNTPNESN QVVNQAIFGS TFISNIGFWL QNSYFSKAEF NPLLHLWSLG VEIQFYLIVP        60
     ILAWFFSKTR FSLVFIVIVS MALCFIVLTI SPKTSFFMMP LRLWEFLLGY GVALYLTQSG       120
     AVKFPKQSWL GFVGLILILL IPFFNVNGES LSIILGHPGA GALLVSIATS IVLVFGLPKI       180
     VEKNIISKGL AILGKYSYSI YLIHFPVIVL YLSEPFMGTI LDIPNVITFI IIFALIFTLS       240
     FTLHKLVETR NFNISITKLS VIFIALIIGL AIIGPWIKTN FISNQEKSIF NAFNDRSTYR       300
     CGKLIRITNP TTLTCNLSED INDTVNKVML VGNSHADSIK TTFIKVAAKH NQAVYFIVQN       360
     NPLMAGGLSP DIVVREAISK EVKHIVVHFS PSGISVSKLK ELVFLAEKNS IKITFIDPVP       420
     VWESHIPKMM YRQLKGFNDN ELQTKDDYLS FNNELFTEVD NISNDNFKRI SIADYFCTPN       480
     CSYKLEDGTP FYFDSGHLTL TGSNVIEKAL NEAISAGKYS EN                          522
//

If you have problems or comments...

PBIL Back to PBIL home page