(data stored in ACNUC7421 zone)

EMBL: CR954246.PE391

CR954246.PE391       Location/Qualifiers
FT   CDS             complement(425137..425622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0407"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence ATP-binding protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85505"
FT                   /db_xref="GOA:Q3IIG3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG3"
FT                   /protein_id="CAI85505.1"
FT                   /translation="MSDAICRTFTKHGGNILLFGASGLGKTHIASSIGYGLIEQGHKVK
FT                   FVAASAIVQQLQQAKRHLRLQDELVKLDKYSLLIVDDVGYVRKTEQETSVLFELIAHRY
FT                   ERHSMIITSNKSFEQWDELFEDSTMTVAAIDRLVHHATIIHCEGDSYRRKTALNKSK"
     MSDAICRTFT KHGGNILLFG ASGLGKTHIA SSIGYGLIEQ GHKVKFVAAS AIVQQLQQAK        60
     RHLRLQDELV KLDKYSLLIV DDVGYVRKTE QETSVLFELI AHRYERHSMI ITSNKSFEQW       120
     DELFEDSTMT VAAIDRLVHH ATIIHCEGDS YRRKTALNKS K                           161
//

If you have problems or comments...

PBIL Back to PBIL home page