(data stored in ACNUC7421 zone)

EMBL: CR954246.PE392

CR954246.PE392       Location/Qualifiers
FT   CDS             425674..425973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0408"
FT                   /product="putative orphan protein ; putative transposase"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85506"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG2"
FT                   /protein_id="CAI85506.1"
FT                   /translation="MRIMRSPEQWRTIIHEQQSSGLTIIDYCRQHQLSMTSFYAVRKKL
FT                   GLSSNNFVRAKITQQVEIVDEQSSITLTVGKANVSLPATTSATYLSQLLREFVQ"
     MRIMRSPEQW RTIIHEQQSS GLTIIDYCRQ HQLSMTSFYA VRKKLGLSSN NFVRAKITQQ        60
     VEIVDEQSSI TLTVGKANVS LPATTSATYL SQLLREFVQ                               99
//

If you have problems or comments...

PBIL Back to PBIL home page