(data stored in ACNUC7421 zone)

EMBL: CR954246.PE393

CR954246.PE393       Location/Qualifiers
FT   CDS             425970..426317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0409"
FT                   /product="putative orphan protein ; putative transposase
FT                   (IS66 family element,Orf2-like)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85507"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG1"
FT                   /protein_id="CAI85507.1"
FT                   /translation="MKMFVEPSEVFLHRDFVDFRKSINGLVSIVEDELVRDAYTGTLFV
FT                   FCNKAKDKLKILYWDKTGFALWYKRLEKQKFKWPSKLSSQEFELTYQQLSWLLSGYDVL
FT                   GHEPLHYQSPI"
     MKMFVEPSEV FLHRDFVDFR KSINGLVSIV EDELVRDAYT GTLFVFCNKA KDKLKILYWD        60
     KTGFALWYKR LEKQKFKWPS KLSSQEFELT YQQLSWLLSG YDVLGHEPLH YQSPI            115
//

If you have problems or comments...

PBIL Back to PBIL home page