(data stored in ACNUC7421 zone)

EMBL: CR954246.PE394

CR954246.PE394       Location/Qualifiers
FT   CDS             426414..427976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0410"
FT                   /product="putative transposase (IS66)"
FT                   /function="4.5 : Transposons and ISs"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85508"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIG0"
FT                   /protein_id="CAI85508.1"
FT                   /translation="MKIDTHSLPDDPEQLKQMLLELQAKTTQELAEKDKIISEQAIQIN
FT                   QFIERYEIAKRKQFGKSSEQLPGARETFNEAEEIIDEADKTLLAAADSHNKITIKNKPT
FT                   RKPLPKELPRKVVTIDVSIDEKMCDCCQGKLHKIGETRSEKLEFVPAYIKVIETVRPKY
FT                   ACKKCEQTGTENSIKVAPVPATPIPKGIATSSLQSQIISAKYQYGLPLYRQEKMFNEYG
FT                   IELSRKTMSDWIIRCSELLMPLVNELKAALLSQAVIHADETPLKVIKADNSSSYMWVYC
FT                   CGSDSVTANSLPNIILYDYHNSRAAACVVDYLGDYDGYLQVDGYAAYGKTDAILAGCMA
FT                   HARRKFIDAKTVQTKNKTGKADVALSLIRKLYGIEASLKDKTAAERYQARQESSKPIID
FT                   KLHHWIIENKDKVPPKSKLGEAITYWCNQEHKLITYLKDGRINIDNNRAERAVKPFVIG
FT                   RKNWLFSNTARGATASAVLYSIIETAKANGLLVDNYLQTCQDELAKKPESVEHLLPWNV
FT                   NQG"
     MKIDTHSLPD DPEQLKQMLL ELQAKTTQEL AEKDKIISEQ AIQINQFIER YEIAKRKQFG        60
     KSSEQLPGAR ETFNEAEEII DEADKTLLAA ADSHNKITIK NKPTRKPLPK ELPRKVVTID       120
     VSIDEKMCDC CQGKLHKIGE TRSEKLEFVP AYIKVIETVR PKYACKKCEQ TGTENSIKVA       180
     PVPATPIPKG IATSSLQSQI ISAKYQYGLP LYRQEKMFNE YGIELSRKTM SDWIIRCSEL       240
     LMPLVNELKA ALLSQAVIHA DETPLKVIKA DNSSSYMWVY CCGSDSVTAN SLPNIILYDY       300
     HNSRAAACVV DYLGDYDGYL QVDGYAAYGK TDAILAGCMA HARRKFIDAK TVQTKNKTGK       360
     ADVALSLIRK LYGIEASLKD KTAAERYQAR QESSKPIIDK LHHWIIENKD KVPPKSKLGE       420
     AITYWCNQEH KLITYLKDGR INIDNNRAER AVKPFVIGRK NWLFSNTARG ATASAVLYSI       480
     IETAKANGLL VDNYLQTCQD ELAKKPESVE HLLPWNVNQG                             520
//

If you have problems or comments...

PBIL Back to PBIL home page