(data stored in ACNUC7421 zone)

EMBL: CR954246.PE395

CR954246.PE395       Location/Qualifiers
FT   CDS             complement(427973..428302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0411"
FT                   /product="putative orphan protein ; putative insertion
FT                   sequence"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF9"
FT                   /protein_id="CAI85509.1"
FT                   /translation="MDNFTASLPLMLKQLKLSTMLQQWNTLGKKAIEEQWSPQQYLSDL
FT                   CHIELATRDDKRLQRLLKDAKLPVGKHLSSFDFTLVDGVSKPLVADLINQPDWLKHGKR
FT                   LSKCV"
     MDNFTASLPL MLKQLKLSTM LQQWNTLGKK AIEEQWSPQQ YLSDLCHIEL ATRDDKRLQR        60
     LLKDAKLPVG KHLSSFDFTL VDGVSKPLVA DLINQPDWLK HGKRLSKCV                   109
//

If you have problems or comments...

PBIL Back to PBIL home page