(data stored in ACNUC7421 zone)

EMBL: CR954246.PE396

CR954246.PE396       Location/Qualifiers
FT   CDS             complement(428295..429311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0412"
FT                   /product="putative orphan protein ; putative transposase
FT                   (partial)"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85510"
FT                   /db_xref="GOA:Q3IIF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF8"
FT                   /protein_id="CAI85510.1"
FT                   /translation="MPASGWAYAQVIYGGESFAAFSDGVQNAFKAAGGVPKEVRTDSLS
FT                   AAYRNHTNDNDFTERFNELVIHYGFKATRNNRGIAHENGAIESPHGHLKSQLEQALKIR
FT                   GSYDFQTRVVYESFVADIVARRNRRVSDKYAVEQRQLHALPKTMSVSYTEHYLTVSRTS
FT                   TVSLKRVTYSVPSRLIGSRLLVRLYDNRLELRYGSDLVQTLARVYASKGCRARNISYLH
FT                   VIDALVKKPLAFRYSQLRDDLLPSDNYKAIWEYVNAHLLADEASYYMVKLLHLAKQSGC
FT                   ERQLGRFVAASITQRQLPAIRECEAQFLVIASNIPTITIKQHSLSAYSSMIPGGLHG"
     MPASGWAYAQ VIYGGESFAA FSDGVQNAFK AAGGVPKEVR TDSLSAAYRN HTNDNDFTER        60
     FNELVIHYGF KATRNNRGIA HENGAIESPH GHLKSQLEQA LKIRGSYDFQ TRVVYESFVA       120
     DIVARRNRRV SDKYAVEQRQ LHALPKTMSV SYTEHYLTVS RTSTVSLKRV TYSVPSRLIG       180
     SRLLVRLYDN RLELRYGSDL VQTLARVYAS KGCRARNISY LHVIDALVKK PLAFRYSQLR       240
     DDLLPSDNYK AIWEYVNAHL LADEASYYMV KLLHLAKQSG CERQLGRFVA ASITQRQLPA       300
     IRECEAQFLV IASNIPTITI KQHSLSAYSS MIPGGLHG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page