(data stored in ACNUC7421 zone)

EMBL: CR954246.PE399

CR954246.PE399       Location/Qualifiers
FT   CDS             complement(430260..430577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0415"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85513"
FT                   /db_xref="GOA:Q3IIF5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF5"
FT                   /protein_id="CAI85513.1"
FT                   /translation="MQNINQQVNNQLSNLKLSGIRDALLQQYEQPNLYVEQSFEERLSL
FT                   LLEHEITQRDQRKVDRLTRQAKFRVGGTLAQLNYGAARQLDKAQIRSLAQGEWLRLHQT
FT                   S"
     MQNINQQVNN QLSNLKLSGI RDALLQQYEQ PNLYVEQSFE ERLSLLLEHE ITQRDQRKVD        60
     RLTRQAKFRV GGTLAQLNYG AARQLDKAQI RSLAQGEWLR LHQTS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page