(data stored in ACNUC7421 zone)

EMBL: CR954246.PE400

CR954246.PE400       Location/Qualifiers
FT   CDS             complement(430606..431715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0416"
FT                   /product="conserved protein of unknown function ; putative
FT                   transposase (IS408)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85514"
FT                   /db_xref="GOA:Q3IIF3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF3"
FT                   /protein_id="CAI85514.1"
FT                   /translation="MDYCGPTMSIVDTSTGECRTAQVFVAVMGASNYTYAEATYSQKLE
FT                   DWVMSHARCFEFLGGVSELIIPDNLKSAVTKPCRYEPDLNPTYQQLATHYDTVIVPARP
FT                   YKPKDKAKAEVGVQIIERWIMARLRNETFFSLRQLNLKIQALLVNLNQRKMKKHPGSRL
FT                   SQFDAIDRPALKPLPTQPYSYTLVKQVSVHIDYHVEIEKHYYSVPHTLIKQKLEAHASG
FT                   KLVTLYHQGIRVAVHPRSYREGAHTTLDLHMPIAHQKQQQWTPQRFERWASKFGTSTEQ
FT                   FVMQLMQAKKHPEQSYRACMGLLRLGKKFSDQRLEAACHRALTTGVTRVKQVKTILEKG
FT                   LDKQPLPQAQGDLLQDIDHKNIRGNHYYH"
     MDYCGPTMSI VDTSTGECRT AQVFVAVMGA SNYTYAEATY SQKLEDWVMS HARCFEFLGG        60
     VSELIIPDNL KSAVTKPCRY EPDLNPTYQQ LATHYDTVIV PARPYKPKDK AKAEVGVQII       120
     ERWIMARLRN ETFFSLRQLN LKIQALLVNL NQRKMKKHPG SRLSQFDAID RPALKPLPTQ       180
     PYSYTLVKQV SVHIDYHVEI EKHYYSVPHT LIKQKLEAHA SGKLVTLYHQ GIRVAVHPRS       240
     YREGAHTTLD LHMPIAHQKQ QQWTPQRFER WASKFGTSTE QFVMQLMQAK KHPEQSYRAC       300
     MGLLRLGKKF SDQRLEAACH RALTTGVTRV KQVKTILEKG LDKQPLPQAQ GDLLQDIDHK       360
     NIRGNHYYH                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page