(data stored in ACNUC7421 zone)

EMBL: CR954246.PE402

CR954246.PE402       Location/Qualifiers
FT   CDS             432912..433061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0418"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIF1"
FT                   /protein_id="CAI85516.1"
FT                   /translation="MFIPKEDGSERGLSIICLEDKIVQQAMVQVLNQIYETDFLGISYG
FT                   FRPE"
     MFIPKEDGSE RGLSIICLED KIVQQAMVQV LNQIYETDFL GISYGFRPE                    49
//

If you have problems or comments...

PBIL Back to PBIL home page